This work is licensed under a Creative Commons Attribution 4.0 International License.
E10-Ctn[15-34]
General Information
DCTPep ID DCTPep03706
Peptide Name E10-Ctn[15-34]
Sequence EEEEEEEEEEKKRLKKIFKKPMVIGVTIPF
Sequence Length 30
UniProt ID U5KJM4
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C165H269N39O52S1
Absent amino acids ACDHNQSWY
Theoretical pI 4.83
Acidic residues 10
Basic residues 7
Polar residues 2
Molecular weight (Average) 3663.24
Molecular weight (Monoisotopic) 3660.93
Common amino acids E
Net charge -3
Instability index (II) 105.27
Aliphatic index 71.33
Grand average of hydropathicity (GRAVY) -1.133
Half Life
1 hours (mammalian reticulocytes, in vitro).
30 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30042491
Title An acidic model pro-peptide affects the secondary structure, membrane interactions and antimicrobial activity of a crotalicidin fragment
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 11541
This work is licensed under a Creative Commons Attribution 4.0 International License.