This work is licensed under a Creative Commons Attribution 4.0 International License.
Dermaseptin-PS1, Dermaseptin cDNA
General Information
DCTPep ID DCTPep03738
Peptide Name Dermaseptin-PS1, Dermaseptin cDNA
Sequence ALWKTMLKKLGTVALHAGKAALGAVADTISQ
Sequence Length 31
UniProt ID A0A284T6N8
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C143H243N39O39S1
Absent amino acids CEFNPRY
Theoretical pI 10.00
Acidic residues 1
Basic residues 5
Polar residues 7
Molecular weight (Average) 3164.8
Molecular weight (Monoisotopic) 3162.8
Common amino acids A
Net charge 4
Instability index (II) 2.25
Aliphatic index 116.77
Grand average of hydropathicity (GRAVY) 0.503
Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.738
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30461197
Title Novel peptide dermaseptin-PS1 exhibits anticancer activity via induction of intrinsic apoptosis signalling
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12112
This work is licensed under a Creative Commons Attribution 4.0 International License.