This work is licensed under a Creative Commons Attribution 4.0 International License.
Arminin-1a (40-70)-AMD
General Information
DCTPep ID DCTPep03743
Peptide Name Arminin-1a (40-70)-AMD
Sequence KPWRFRRAIRRVRWRKVAPYIPFVVKTVGKK
Sequence Length 31
UniProt ID D2XUU4
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C185H301N59O34
Absent amino acids CDEHLMNQS
Theoretical pI 12.41
Acidic residues 0
Basic residues 12
Polar residues 3
Molecular weight (Average) 3895.8
Molecular weight (Monoisotopic) 3893.36
Common amino acids R
Net charge 12
Instability index (II) 64.1
Aliphatic index 78.39
Grand average of hydropathicity (GRAVY) -0.671
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 3.206
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30464401
Title Arminin 1a-C, a novel antimicrobial peptide from ancient metazoan Hydra, shows potent antileukemia activity against drug-sensitive and drug-resistant leukemia cells
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12161
This work is licensed under a Creative Commons Attribution 4.0 International License.