This work is licensed under a Creative Commons Attribution 4.0 International License.
Nicomicin-1
General Information
DCTPep ID DCTPep03753
Peptide Name Nicomicin-1
Sequence GFWSSVWDGAKNVGTAIIKNAKVCVYAVCVSHK
Sequence Length 33
UniProt ID A0A3G2WH77
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 6HN9
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C161H249N43O43S2
Absent amino acids ELMPQR
Theoretical pI 9.24
Acidic residues 1
Basic residues 5
Polar residues 12
Molecular weight (Average) 3539.13
Molecular weight (Monoisotopic) 3536.81
Common amino acids V
Net charge 4
Instability index (II) 10.17
Aliphatic index 88.48
Grand average of hydropathicity (GRAVY) 0.379
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 12615
Abs 0.1% (=1 g/l) 3.564, assuming all pairs of Cys residues form cystines
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 3.529, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30360541
Title Novel Antimicrobial Peptides from the Arctic Polychaeta Nicomache minor Provide New Molecular Insight into Biological Role of the BRICHOS Domain
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12236
This work is licensed under a Creative Commons Attribution 4.0 International License.