This work is licensed under a Creative Commons Attribution 4.0 International License.
Brachyin
General Information
DCTPep ID DCTPep03773
Peptide Name Brachyin
Sequence CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS
Sequence Length 41
UniProt ID Not available
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C215H309N57O64S6
Absent amino acids FHIMQ
Theoretical pI 7.74
Acidic residues 5
Basic residues 6
Polar residues 21
Molecular weight (Average) 4908.52
Molecular weight (Monoisotopic) 4905.1
Common amino acids CY
Net charge 1
Instability index (II) 65.64
Aliphatic index 28.54
Grand average of hydropathicity (GRAVY) -0.971
Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 20315
Abs 0.1% (=1 g/l) 4.139, assuming all pairs of Cys residues form cystines
Ext. coefficient 19940
Abs 0.1% (=1 g/l) 4.062, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 25329070
Title A novel neurotoxin from venom of the spider, Brachypelma albopilosum
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12435
This work is licensed under a Creative Commons Attribution 4.0 International License.