Brachyin

General Information


DCTPep ID  DCTPep03773

Peptide Name   Brachyin

Sequence  CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS

Sequence Length  41

UniProt ID  Not available

PubChem CID  Not available

Origin  Animalia

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C215H309N57O64S6

Absent amino acids  FHIMQ

Theoretical pI  7.74

Acidic residues  5

Basic residues  6

Polar residues  21

Molecular weight (Average)  4908.52

Molecular weight (Monoisotopic)  4905.1

Common amino acids  CY

Net charge  1

Instability index (II)  65.64

Aliphatic index  28.54

Grand average of hydropathicity (GRAVY)  -0.971

Half Life 
  1.2 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 20315
  Abs 0.1% (=1 g/l) 4.139, assuming all pairs of Cys residues form cystines
  Ext. coefficient 19940
  Abs 0.1% (=1 g/l) 4.062, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 25329070

Title  A novel neurotoxin from venom of the spider, Brachypelma albopilosum

Doi Not available

Year  2014

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  12435

DCTPep is developed by Dr.Zheng's team.