Cathelicidin Ps-CATH6

General Information


DCTPep ID  DCTPep03774

Peptide Name   Cathelicidin Ps-CATH6

Sequence  KKPSKKPKPQAMTFPKVTVEYFPASFSTAALTVPED

Sequence Length  36

UniProt ID  A0A2Z4HVI6 

PubChem CID  Not available

Origin  Animalia

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C184H289N43O52S1

Absent amino acids  CGHINRW

Theoretical pI  9.60

Acidic residues  3

Basic residues  6

Polar residues  8

Molecular weight (Average)  3967.64

Molecular weight (Monoisotopic)  3965.1

Common amino acids  KP

Net charge  3

Instability index (II)  43.63

Aliphatic index  46.11

Grand average of hydropathicity (GRAVY)  -0.544

Half Life 
  1.3 hours (mammalian reticulocytes, in vitro).
  3 min (yeast, in vivo).
  3 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.376

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 30452933

Title  Roles of polymorphic cathelicidins in innate immunity of soft-shell turtle, Pelodiscus sinensis

Doi Not available

Year  2019

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  12436

DCTPep is developed by Dr.Zheng's team.