This work is licensed under a Creative Commons Attribution 4.0 International License.
Cathelicidin Ps-CATH6
General Information
DCTPep ID DCTPep03774
Peptide Name Cathelicidin Ps-CATH6
Sequence KKPSKKPKPQAMTFPKVTVEYFPASFSTAALTVPED
Sequence Length 36
UniProt ID A0A2Z4HVI6
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C184H289N43O52S1
Absent amino acids CGHINRW
Theoretical pI 9.60
Acidic residues 3
Basic residues 6
Polar residues 8
Molecular weight (Average) 3967.64
Molecular weight (Monoisotopic) 3965.1
Common amino acids KP
Net charge 3
Instability index (II) 43.63
Aliphatic index 46.11
Grand average of hydropathicity (GRAVY) -0.544
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.376
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30452933
Title Roles of polymorphic cathelicidins in innate immunity of soft-shell turtle, Pelodiscus sinensis
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12436
This work is licensed under a Creative Commons Attribution 4.0 International License.