This work is licensed under a Creative Commons Attribution 4.0 International License.
Melittin (12-26)[A4L]-AGP-Thanatin
General Information
DCTPep ID DCTPep03776
Peptide Name Melittin (12-26)[A4L]-AGP-Thanatin
Sequence GLPLLISWIKRKRQQAGPGSKKPVPIIYCNRRTGKCQRM
Sequence Length 39
UniProt ID P55788
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C198H338N64O48S3
Absent amino acids DEFH
Theoretical pI 11.50
Acidic residues 0
Basic residues 10
Polar residues 11
Molecular weight (Average) 4479.44
Molecular weight (Monoisotopic) 4476.51
Common amino acids KR
Net charge 10
Instability index (II) 55.44
Aliphatic index 80.00
Grand average of hydropathicity (GRAVY) -0.672
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7115
Abs 0.1% (=1 g/l) 1.588, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.560, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30701481
Title Design and activity study of a melittin-thanatin hybrid peptide
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12528
This work is licensed under a Creative Commons Attribution 4.0 International License.