This work is licensed under a Creative Commons Attribution 4.0 International License.
Cecropin-B [E27Q]
General Information
DCTPep ID DCTPep03820
Peptide Name Cecropin-B [E27Q]
Sequence RWKIFKKIEKMGRNIRDGIVKAGPAIQVLGSAKAI
Sequence Length 35
UniProt ID P04142
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C177H303N53O43S1
Absent amino acids CHTY
Theoretical pI 11.17
Acidic residues 2
Basic residues 9
Polar residues 6
Molecular weight (Average) 3893.74
Molecular weight (Monoisotopic) 3891.29
Common amino acids IK
Net charge 7
Instability index (II) 52.56
Aliphatic index 106.00
Grand average of hydropathicity (GRAVY) -0.134
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.413
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31045339
Title Enhanced Silkworm Cecropin B Antimicrobial Activity against Pseudomonas aeruginosa from Single Amino Acid Variation
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 13146
This work is licensed under a Creative Commons Attribution 4.0 International License.