Cecropin-B [E27Q]

General Information


DCTPep ID  DCTPep03820

Peptide Name   Cecropin-B [E27Q]

Sequence  RWKIFKKIEKMGRNIRDGIVKAGPAIQVLGSAKAI

Sequence Length  35

UniProt ID  P04142 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C177H303N53O43S1

Absent amino acids  CHTY

Theoretical pI  11.17

Acidic residues  2

Basic residues  9

Polar residues  6

Molecular weight (Average)  3893.74

Molecular weight (Monoisotopic)  3891.29

Common amino acids  IK

Net charge  7

Instability index (II)  52.56

Aliphatic index  106.00

Grand average of hydropathicity (GRAVY)  -0.134

Half Life 
  1 hours (mammalian reticulocytes, in vitro).
  2 min (yeast, in vivo).
  2 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.413

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31045339

Title  Enhanced Silkworm Cecropin B Antimicrobial Activity against Pseudomonas aeruginosa from Single Amino Acid Variation

Doi Not available

Year  2019

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  13146

DCTPep is developed by Dr.Zheng's team.