This work is licensed under a Creative Commons Attribution 4.0 International License.
Cm-CATH2
General Information
DCTPep ID DCTPep03824
Peptide Name Cm-CATH2
Sequence RRSRFGRFFKKVRKQLGRVLRHSRITVGGRMRF
Sequence Length 33
UniProt ID M7BBJ0
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C181H307N69O38S1
Absent amino acids ACDENPWY
Theoretical pI 12.96
Acidic residues 0
Basic residues 14
Polar residues 7
Molecular weight (Average) 4089.93
Molecular weight (Monoisotopic) 4087.39
Common amino acids R
Net charge 14
Instability index (II) 62.65
Aliphatic index 61.82
Grand average of hydropathicity (GRAVY) -0.894
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31121185
Title Diversity, immunoregulatory action and structure-activity relationship of green sea turtle cathelicidins
Doi Not available
Year 0
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 13254
This work is licensed under a Creative Commons Attribution 4.0 International License.