DCTPep ID  DCTPep04012

Peptide Name   Defensin BmKDfsin4

Sequence  GFGCPFNQGQCHKHCQSIRRRGGYCDGFLKTRCVCYR

Sequence Length  37

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Native peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys4<--->Cys25; Cys11<--->Cys33; Cys15<--->Cys35

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -0.714

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 3355
  Abs 0.1% (=1 g/l) 0.783, assuming all pairs of Cys residues form cystines
  Ext. coefficient 2980
  Abs 0.1% (=1 g/l) 0.696, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID 27128943

Title  A Scorpion Defensin BmKDfsin4 Inhibits Hepatitis B Virus Replication in Vitro

Doi Not available

Year  2016

Literature 2

Pubmed ID 26817841

Title  Scorpion Potassium Channel-blocking Defensin Highlights a Functional Link with Neurotoxin

Doi Not available

Year  2016

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available

DBAASP ID  15563