This work is licensed under a Creative Commons Attribution 4.0 International License.
Cecropin Satanin 1
General Information
DCTPep ID DCTPep04173
Peptide Name Cecropin Satanin 1
Sequence RSKKWRKIEKRVKKIFEKTKEALPVIQGVATIVGAVGR
Sequence Length 38
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C198H344N60O49
Absent amino acids CDHMNY
Theoretical pI 11.17
Acidic residues 3
Basic residues 12
Polar residues 6
Molecular weight (Average) 4349.28
Molecular weight (Monoisotopic) 4346.63
Common amino acids K
Net charge 9
Instability index (II) 37.42
Aliphatic index 97.37
Grand average of hydropathicity (GRAVY) -0.476
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.265
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 34391826
Title Novel antimicrobial cecropins derived from O curvicornis and D satanas dung beetles
Doi Not available
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 18070
This work is licensed under a Creative Commons Attribution 4.0 International License.