DCTPep ID  DCTPep04340

Peptide Name   Esculentin-2 HYba1

Sequence  SIFSLFKMGAKALGKTLLKQAGKAGAEYAACKATNQC

Sequence Length  37

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys31>--->Cys37

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  0.089

Half Life 
  1.9 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1615
  Abs 0.1% (=1 g/l) 0.423, assuming all pairs of Cys residues form cystines
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.390, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID 31328553

Title  Identification and functional characterisation of Esculentin-2 HYba peptides and their C-terminally amidated analogs from the skin secretion of an endemic frog

Doi Not available

Year  2021

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available

DBAASP ID  18985