Esculentin-2 HYba2
General Information
DCTPep ID DCTPep04341
Peptide Name Esculentin-2 HYba2
Sequence SILSLFKMGAKALGKTLIKQAGKAGAEYVACKATNQC
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Cys31>--->Cys37
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C168H286N46O48S3
Absent amino acids DHPRW
Theoretical pI 9.70
Acidic residues 1
Basic residues 6
Polar residues 12
Molecular weight (Average) 3814.58
Molecular weight (Monoisotopic) 3812.05
Common amino acids A
Net charge 5
Instability index (II) 18.35
Aliphatic index 90.00
Grand average of hydropathicity (GRAVY) 0.200
Half Life
1.9 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1615
Abs 0.1% (=1 g/l) 0.423, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.391, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31328553
Title Identification and functional characterisation of Esculentin-2 HYba peptides and their C-terminally amidated analogs from the skin secretion of an endemic frog
Doi Not available
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 18987