Esculentin-2 HYba2

General Information


DCTPep ID  DCTPep04341

Peptide Name   Esculentin-2 HYba2

Sequence  SILSLFKMGAKALGKTLIKQAGKAGAEYVACKATNQC

Sequence Length  37

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Cys31>--->Cys37

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C168H286N46O48S3

Absent amino acids  DHPRW

Theoretical pI  9.70

Acidic residues  1

Basic residues  6

Polar residues  12

Molecular weight (Average)  3814.58

Molecular weight (Monoisotopic)  3812.05

Common amino acids  A

Net charge  5

Instability index (II)  18.35

Aliphatic index  90.00

Grand average of hydropathicity (GRAVY)  0.200

Half Life 
  1.9 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1615
  Abs 0.1% (=1 g/l) 0.423, assuming all pairs of Cys residues form cystines
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.391, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31328553

Title  Identification and functional characterisation of Esculentin-2 HYba peptides and their C-terminally amidated analogs from the skin secretion of an endemic frog

Doi Not available

Year  2021

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  18987

DCTPep is developed by Dr.Zheng's team.