Peptide Libraray

Actinomycesin AMSIN, Defensin-like Bacteriocin

General Information

DCTPep ID DCTPep04356

Peptide Name Actinomycesin AMSIN, Defensin-like Bacteriocin

Sequence GFGCPWNAYECDRHCVSKGYTGGNCRGKIRQTCHCY

Sequence Length 36

UniProt ID E7N5J9

PubChem CID Not available

Origin Bacteria

Type Native peptide

Classification

Cancer therapy related peptides

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID 2RU0

Predicted Structure Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys4<--->Cys25; Cys11<--->Cys33; Cys15<--->Cys35

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C171H253N55O50S6

Absent amino acids LM

Theoretical pI 8.65

Acidic residues 2

Basic residues 7

Polar residues 20

Molecular weight (Average) 4071.59

Molecular weight (Monoisotopic) 4068.73

Common amino acids CG

Net charge 5

Instability index (II) 32.49

Aliphatic index 21.67

Grand average of hydropathicity (GRAVY) -0.775

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 10345
Abs 0.1% (=1 g/l) 2.541, assuming all pairs of Cys residues form cystines
Ext. coefficient 9970
Abs 0.1% (=1 g/l) 2.449, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 34927385

Title Adaptively evolved human oral actinomyces-sourced defensins show therapeutic potential

Doi Not available

Year 2022

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID 19007