This work is licensed under a Creative Commons Attribution 4.0 International License.
Defensin BmKDfsin3
General Information
DCTPep ID DCTPep04377
Peptide Name Defensin BmKDfsin3
Sequence GFGCPFNQGKCHRHCRSIRRRGGYCDGFLKQRCVCYRK
Sequence Length 38
UniProt ID Not available
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys25; Cys11<--->Cys33; Cys15<--->Cys35
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C190H299N69O47S6
Absent amino acids AEMTW
Theoretical pI 10.00
Acidic residues 1
Basic residues 12
Polar residues 16
Molecular weight (Average) 4494.26
Molecular weight (Monoisotopic) 4491.15
Common amino acids R
Net charge 11
Instability index (II) 72.42
Aliphatic index 28.16
Grand average of hydropathicity (GRAVY) -0.924
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 3355
Abs 0.1% (=1 g/l) 0.747, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.663, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31963532
Title Inhibitory Activity of a Scorpion Defensin BmKDfsin3 against Hepatitis C Virus
Doi Not available
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 19218
This work is licensed under a Creative Commons Attribution 4.0 International License.