This work is licensed under a Creative Commons Attribution 4.0 International License.
hBD-1
General Information
DCTPep ID DCTPep04652
Peptide Name hBD-1
Sequence DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Sequence Length 36
UniProt ID P60022 DEFB1_HUMAN P61263 A4H1Z4
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 2NLC 1E4S 2NLG 2NLB 2NLH 2PLZ 1IJV 2NLD 2NLF 2NLQ 2NLE 1KJ5 2NLP 1IJU 2NLS
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys5<--->Cys34; Cys12<--->Cys27; Cys17<--->Cys35
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C167H262N48O50S6
Absent amino acids EMW
Theoretical pI 8.87
Acidic residues 1
Basic residues 6
Polar residues 19
Molecular weight (Average) 3934.57
Molecular weight (Monoisotopic) 3931.78
Common amino acids C
Net charge 5
Instability index (II) 34.49
Aliphatic index 46.11
Grand average of hydropathicity (GRAVY) -0.272
Half Life
1.1 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 4845
Abs 0.1% (=1 g/l) 1.231, assuming all pairs of Cys residues form cystines
Ext. coefficient 4470
Abs 0.1% (=1 g/l) 1.136, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 7628632
Title Not available
Doi Not available
Year Not available
Literature 2
Pubmed ID 28856417
Title Not available
Doi Not available
Year Not available
Literature 3
Pubmed ID 23980689
Title Not available
Doi Not available
Year Not available
Literature 4
Pubmed ID 23389903
Title Not available
Doi Not available
Year Not available
Literature 5
Pubmed ID 22664071
Title Not available
Doi Not available
Year Not available
Literature 6
Pubmed ID 21672084
Title Not available
Doi Not available
Year Not available
Literature 7
Pubmed ID 18957441
Title Not available
Doi Not available
Year Not available
Literature 8
Pubmed ID 18809937
Title Not available
Doi Not available
Year Not available
Literature 9
Pubmed ID 18782756
Title Not available
Doi Not available
Year Not available
Literature 10
Pubmed ID 15245864
Title Not available
Doi Not available
Year Not available
Literature 11
Pubmed ID 15177279
Title Not available
Doi Not available
Year Not available
Literature 12
Pubmed ID 12825184
Title Not available
Doi Not available
Year Not available
Literature 13
Pubmed ID 11862391
Title Not available
Doi Not available
Year Not available
Literature 14
Pubmed ID 11741980
Title Not available
Doi Not available
Year Not available
Literature 15
Pubmed ID 11714914
Title Not available
Doi Not available
Year Not available
Literature 16
Pubmed ID 11486002
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
This work is licensed under a Creative Commons Attribution 4.0 International License.