This work is licensed under a Creative Commons Attribution 4.0 International License.
Buforin-1
General Information
DCTPep ID DCTPep04654
Peptide Name Buforin-1
Sequence AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
Sequence Length 39
UniProt ID P55897
PubChem CID Not available
Origin Bufo bufo
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 4LD9
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C184H318N70O47
Absent amino acids CDEIMW
Theoretical pI 12.41
Acidic residues 0
Basic residues 13
Polar residues 12
Molecular weight (Average) 4262.99
Molecular weight (Monoisotopic) 4260.46
Common amino acids GR
Net charge 13
Instability index (II) 46.13
Aliphatic index 62.56
Grand average of hydropathicity (GRAVY) -0.992
Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.350
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 8946958
Title Not available
Doi Not available
Year Not available
Literature 2
Pubmed ID 8573171
Title Not available
Doi Not available
Year Not available
Literature 3
Pubmed ID 30570475
Title Not available
Doi Not available
Year Not available
Literature 4
Pubmed ID 26091834
Title Not available
Doi Not available
Year Not available
Literature 5
Pubmed ID 23724649
Title Not available
Doi Not available
Year Not available
Literature 6
Pubmed ID 21672084
Title Not available
Doi Not available
Year Not available
Literature 7
Pubmed ID 10890923
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DRAMP ID DRAMP01162
This work is licensed under a Creative Commons Attribution 4.0 International License.