DCTPep ID  DCTPep04682

Peptide Name   Human lactoferricin

Sequence  GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA

Sequence Length  49

UniProt ID  P02788 

PubChem CID  Not available

Origin  Arabidopsis thaliana

Type  Native peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  1Z6V  1Z6W  1CB6 

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Amidation

C-terminal Modification  Amidation

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -0.851

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 11250
  Abs 0.1% (=1 g/l) 1.959, assuming all pairs of Cys residues form cystines
  Ext. coefficient 11000
  Abs 0.1% (=1 g/l) 1.915, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID 24703967

Title  Not available

Doi Not available

Year  Not available

Literature 2

Pubmed ID 17481742

Title  Not available

Doi Not available

Year  Not available

Literature 3

Pubmed ID 16048952

Title  Not available

Doi Not available

Year  Not available

Literature 4

Pubmed ID 11254635

Title  Not available

Doi Not available

Year  Not available

Literature 5

Pubmed ID 10066056

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available

DBAASP ID  8171