This work is licensed under a Creative Commons Attribution 4.0 International License.
L-amino-acid oxidase (LAAO, LAO; BpirLAAO-I; reptilia, animals)
General Information
DCTPep ID DCTPep04705
Peptide Name L-amino-acid oxidase (LAAO, LAO; BpirLAAO-I; reptilia, animals)
Sequence ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY
Sequence Length 49
UniProt ID P0C2D1
PubChem CID Not available
Origin Bothrops pirajai
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C235H375N63O74S1
Absent amino acids CHQW
Theoretical pI 5.15
Acidic residues 7
Basic residues 6
Polar residues 14
Molecular weight (Average) 5299
Molecular weight (Monoisotopic) 5295.72
Common amino acids A
Net charge -1
Instability index (II) 10.31
Aliphatic index 85.71
Grand average of hydropathicity (GRAVY) -0.253
Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.562
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 16809041
Title Biochemical and functional characterization of an L-amino acid oxidase isolated from Bothrops pirajai snake venom
Year 2006
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DRAMP ID DRAMP02902
This work is licensed under a Creative Commons Attribution 4.0 International License.