Microcin E492

General Information


DCTPep ID  DCTPep04707

Peptide Name   Microcin E492

Sequence  GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVFIPVLIGPSWNGSGSGYNSATSSSGSGS

Sequence Length  84

UniProt ID  P82962  Q9Z4N4 

PubChem CID  Not available

Origin  Klebsiella pneumoniae

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

SequenceNo structure available

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C342H532N98O118S1

Absent amino acids  CKR

Theoretical pI  3.84

Acidic residues  4

Basic residues  1

Polar residues  41

Molecular weight (Average)  7936.63

Molecular weight (Monoisotopic)  7931.84

Common amino acids  G

Net charge  -3

Instability index (II)  18.91

Aliphatic index  81.43

Grand average of hydropathicity (GRAVY)  0.065

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 12490
  Abs 0.1% (=1 g/l) 1.574

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 7682973

Title  Not available

Doi Not available

Year  Not available

Literature 2

Pubmed ID 6385903

Title  Not available

Doi Not available

Year  Not available

Literature 3

Pubmed ID 19884380

Title  Not available

Doi Not available

Year  Not available

Literature 4

Pubmed ID 18957441

Title  Not available

Doi Not available

Year  Not available

Literature 5

Pubmed ID 15102848

Title  Not available

Doi Not available

Year  Not available

Literature 6

Pubmed ID 12890026

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRAMP ID  DRAMP00222

CancerPPD ID  4385

DCTPep is developed by Dr.Zheng's team.