This work is licensed under a Creative Commons Attribution 4.0 International License.
Microcin E492
General Information
DCTPep ID DCTPep04707
Peptide Name Microcin E492
Sequence GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVFIPVLIGPSWNGSGSGYNSATSSSGSGS
Sequence Length 84
PubChem CID Not available
Origin Klebsiella pneumoniae
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C342H532N98O118S1
Absent amino acids CKR
Theoretical pI 3.84
Acidic residues 4
Basic residues 1
Polar residues 41
Molecular weight (Average) 7936.63
Molecular weight (Monoisotopic) 7931.84
Common amino acids G
Net charge -3
Instability index (II) 18.91
Aliphatic index 81.43
Grand average of hydropathicity (GRAVY) 0.065
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 1.574
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 7682973
Title Not available
Doi Not available
Year Not available
Literature 2
Pubmed ID 6385903
Title Not available
Doi Not available
Year Not available
Literature 3
Pubmed ID 19884380
Title Not available
Doi Not available
Year Not available
Literature 4
Pubmed ID 18957441
Title Not available
Doi Not available
Year Not available
Literature 5
Pubmed ID 15102848
Title Not available
Doi Not available
Year Not available
Literature 6
Pubmed ID 12890026
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DRAMP ID DRAMP00222
CancerPPD ID 4385
This work is licensed under a Creative Commons Attribution 4.0 International License.