This work is licensed under a Creative Commons Attribution 4.0 International License.
Porcine NK-Lysin
General Information
DCTPep ID DCTPep04708
Peptide Name Porcine NK-Lysin
Sequence GLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE
Sequence Length 78
PubChem CID Not available
Origin Sus scrofa
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 1NKL
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C380H664N112O109S9
Absent amino acids HWY
Theoretical pI 9.47
Acidic residues 9
Basic residues 17
Polar residues 18
Molecular weight (Average) 8834.68
Molecular weight (Monoisotopic) 8828.73
Common amino acids KI
Net charge 8
Instability index (II) 36.01
Aliphatic index 97.44
Grand average of hydropathicity (GRAVY) -0.213
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 375
Abs 0.1% (=1 g/l) 0.042, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 9334742
Title Not available
Doi Not available
Year Not available
Literature 2
Pubmed ID 7737114
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DRAMP ID DRAMP02980
This work is licensed under a Creative Commons Attribution 4.0 International License.