Peptide Libraray

Varv peptide B (Varv B; Plant defensin)

General Information

DCTPep ID DCTPep04709

Peptide Name Varv peptide B (Varv B; Plant defensin)

Sequence GLPVCGETCFGGTCNTPGCSCDPWPMCSRN

Sequence Length 30

UniProt ID P58447

PubChem CID Not available

Origin Viola arvensis

Type Native peptide

Classification

Cancer therapy related peptides

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID 1KAL

Predicted Structure Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys5<--->Cys19; Cys9<--->Cys21; Cys14<--->Cys27; NCB: Gly1<--->Asn30

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C125H190N36O42S7

Absent amino acids AHIKQY

Theoretical pI 4.37

Acidic residues 2

Basic residues 1

Polar residues 18

Molecular weight (Average) 3093.52

Molecular weight (Monoisotopic) 3091.19

Common amino acids C

Net charge -1

Instability index (II) 42.79

Aliphatic index 22.67

Grand average of hydropathicity (GRAVY) -0.127

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5875
Abs 0.1% (=1 g/l) 1.899, assuming all pairs of Cys residues form cystines
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.778, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 26399495

Title Not available

Doi Not available

Year Not available

Literature 2

Pubmed ID 10075760

Title Not available

Doi Not available

Year Not available

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DRAMP ID DRAMP00785