Varv peptide B (Varv B; Plant defensin)
General Information
DCTPep ID DCTPep04709
Peptide Name Varv peptide B (Varv B; Plant defensin)
Sequence GLPVCGETCFGGTCNTPGCSCDPWPMCSRN
Sequence Length 30
UniProt ID P58447
PubChem CID Not available
Origin Viola arvensis
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 1KAL
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys5<--->Cys19; Cys9<--->Cys21; Cys14<--->Cys27; NCB: Gly1<--->Asn30
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C125H190N36O42S7
Absent amino acids AHIKQY
Theoretical pI 4.37
Acidic residues 2
Basic residues 1
Polar residues 18
Molecular weight (Average) 3093.52
Molecular weight (Monoisotopic) 3091.19
Common amino acids C
Net charge -1
Instability index (II) 42.79
Aliphatic index 22.67
Grand average of hydropathicity (GRAVY) -0.127
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5875
Abs 0.1% (=1 g/l) 1.899, assuming all pairs of Cys residues form cystines
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.778, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26399495
Title Not available
Doi Not available
Year Not available
Literature 2
Pubmed ID 10075760
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DRAMP ID DRAMP00785