DCTPep ID  DCTPep04716

Peptide Name   Granulysin 

Sequence  GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL

Sequence Length  83

UniProt ID  P22749 

PubChem CID  Not available

Origin  Homo sapiens

Type  Native peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  1L9L 

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -0.614

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 8730
  Abs 0.1% (=1 g/l) 0.916, assuming all pairs of Cys residues form cystines
  Ext. coefficient 8480
  Abs 0.1% (=1 g/l) 0.890, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID 9756476

Title  Not available

Doi Not available

Year  Not available

Literature 2

Pubmed ID 27276051

Title  Not available

Doi Not available

Year  Not available

Literature 3

Pubmed ID 12488100

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available

DRAMP ID  DRAMP03557