This work is licensed under a Creative Commons Attribution 4.0 International License.
Viphi G
General Information
DCTPep ID DCTPep04717
Peptide Name Viphi G
Sequence GSIPCEGSCVFIPCISAIIGCSCSNKVCYKN
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Oldenlandia affinis
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C135H219N35O42S6
Absent amino acids DHLMQRTW
Theoretical pI 7.77
Acidic residues 1
Basic residues 2
Polar residues 17
Molecular weight (Average) 3196.79
Molecular weight (Monoisotopic) 3194.44
Common amino acids C
Net charge 1
Instability index (II) 26.45
Aliphatic index 84.84
Grand average of hydropathicity (GRAVY) 0.726
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.583, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.466, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21723349
Title Not available
Doi Not available
Year Not available
Literature 2
Pubmed ID 18957441
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
CancerPPD ID 4379
This work is licensed under a Creative Commons Attribution 4.0 International License.