This work is licensed under a Creative Commons Attribution 4.0 International License.
Curcuma longa (Turmeric) (Curcuma domestica)
General Information
DCTPep ID DCTPep04719
Peptide Name Curcuma longa (Turmeric) (Curcuma domestica)
Sequence LCPLDVLQLSSELLDIDGNEVEASRILSDITAFGGIRCPLTVVQSRGIGTIISSPYRFIAEGHPLSLKDMDGWFRVSDDEFNNYK
Sequence Length 85
UniProt ID P85278
PubChem CID Not available
Origin Curcuma longa
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 2L3I
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C418H658N110O131S3
Absent amino acids Not Applicable
Theoretical pI 4.43
Acidic residues 13
Basic residues 8
Polar residues 26
Molecular weight (Average) 9416.66
Molecular weight (Monoisotopic) 9410.74
Common amino acids LS
Net charge -5
Instability index (II) 36.77
Aliphatic index 103.18
Grand average of hydropathicity (GRAVY) 0.000
Half Life
5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 8605
Abs 0.1% (=1 g/l) 0.914, assuming all pairs of Cys residues form cystines
Ext. coefficient 8480
Abs 0.1% (=1 g/l) 0.901, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18177267
Title New biological activity against phospholipase A2 by Turmerin, a protein from Curcuma longa L
Year 2008
Literature 2
Pubmed ID 1731625
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DRAMP ID DRAMP02472
This work is licensed under a Creative Commons Attribution 4.0 International License.