This work is licensed under a Creative Commons Attribution 4.0 International License.
TPP3
General Information
DCTPep ID DCTPep04720
Peptide Name TPP3
Sequence QICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC
Sequence Length 47
UniProt ID Not available
PubChem CID Not available
Origin Planctomyces brasiliensis
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 4UJ0
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C227H369N65O63S9
Absent amino acids NVW
Theoretical pI 9.20
Acidic residues 2
Basic residues 10
Polar residues 19
Molecular weight (Average) 5305.36
Molecular weight (Monoisotopic) 5301.52
Common amino acids C
Net charge 8
Instability index (II) 55.9
Aliphatic index 43.62
Grand average of hydropathicity (GRAVY) -0.364
Half Life
0.8 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1990
Abs 0.1% (=1 g/l) 0.375, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.281, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 7647301
Title Not available
Doi Not available
Year Not available
Literature 2
Pubmed ID 22442231
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.