Peptide Libraray

Gaegurin-5

General Information

DCTPep ID DCTPep04736

Peptide Name Gaegurin-5

Sequence MFTLKKSLLLLFFLGTISLSLCEEERNADEEEKRDVEVEKRFLGALFKVASKVLPSVFCAITKKC

Sequence Length 65

UniProt ID Q91329 P80399

PubChem CID Not available

Origin Glandirana rugosa

Type Native peptide

Classification

Cancer therapy related peptides

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Not available

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C337H551N83O95S4

Absent amino acids HQWY

Theoretical pI 7.68

Acidic residues 10

Basic residues 11

Polar residues 14

Molecular weight (Average) 7413.82

Molecular weight (Monoisotopic) 7408.97

Common amino acids L

Net charge 1

Instability index (II) 37.61

Aliphatic index 106.46

Grand average of hydropathicity (GRAVY) 0.208

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 125
Abs 0.1% (=1 g/l) 0.017, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 7999137

Title Not available

Doi Not available

Year Not available

Literature 2

Pubmed ID 7733950

Title Not available

Doi Not available

Year Not available

Literature 3

Pubmed ID 19059199

Title Not available

Doi Not available

Year Not available

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available