PaDef
General Information
DCTPep ID DCTPep04744
Peptide Name PaDef
Sequence CETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC
Sequence Length 45
UniProt ID Not available
PubChem CID Not available
Origin Persea americana
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C203H329N71O61S9
Absent amino acids WY
Theoretical pI 8.77
Acidic residues 3
Basic residues 10
Polar residues 20
Molecular weight (Average) 5028.82
Molecular weight (Monoisotopic) 5025.23
Common amino acids C
Net charge 7
Instability index (II) 51.17
Aliphatic index 41.11
Grand average of hydropathicity (GRAVY) -0.456
Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 500
Abs 0.1% (=1 g/l) 0.099, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24319695
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available