Lunasin

General Information


DCTPep ID  DCTPep04751

Peptide Name   Lunasin

Sequence  SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD

Sequence Length  43

UniProt ID  Not available

PubChem CID  Not available

Origin  Glycine max

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C204H321N65O78S3

Absent amino acids  AFY

Theoretical pI  4.43

Acidic residues  12

Basic residues  8

Polar residues  9

Molecular weight (Average)  5028.36

Molecular weight (Monoisotopic)  5025.23

Common amino acids  D

Net charge  -4

Instability index (II)  48.39

Aliphatic index  43.02

Grand average of hydropathicity (GRAVY)  -1.763

Half Life 
  1.9 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5625
  Abs 0.1% (=1 g/l) 1.119, assuming all pairs of Cys residues form cystines
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.094, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 10331812

Title  A soybean cDNA encoding a chromatin-binding peptide inhibits mitosis of mammalian cells

Doi 10.1038/8676

Year  1999

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.