This work is licensed under a Creative Commons Attribution 4.0 International License.
Lunasin
General Information
DCTPep ID DCTPep04751
Peptide Name Lunasin
Sequence SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD
Sequence Length 43
UniProt ID Not available
PubChem CID Not available
Origin Glycine max
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C204H321N65O78S3
Absent amino acids AFY
Theoretical pI 4.43
Acidic residues 12
Basic residues 8
Polar residues 9
Molecular weight (Average) 5028.36
Molecular weight (Monoisotopic) 5025.23
Common amino acids D
Net charge -4
Instability index (II) 48.39
Aliphatic index 43.02
Grand average of hydropathicity (GRAVY) -1.763
Half Life
1.9 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5625
Abs 0.1% (=1 g/l) 1.119, assuming all pairs of Cys residues form cystines
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.094, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 10331812
Title A soybean cDNA encoding a chromatin-binding peptide inhibits mitosis of mammalian cells
Doi 10.1038/8676
Year 1999
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.