This work is licensed under a Creative Commons Attribution 4.0 International License.
Cycloviolacin O2
General Information
DCTPep ID DCTPep04757
Peptide Name Cycloviolacin O2
Sequence CGESCVWIPCISSAIGCSCKSKVCYRNGIP
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Viola odorata
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys1<--->Cys18; Cys5<--->Cys20; Cys10<--->Cys25
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C133H215N37O40S6
Absent amino acids DFHLMQT
Theoretical pI 8.33
Acidic residues 1
Basic residues 3
Polar residues 16
Molecular weight (Average) 3164.75
Molecular weight (Monoisotopic) 3162.43
Common amino acids C
Net charge 2
Instability index (II) 22.59
Aliphatic index 74.67
Grand average of hydropathicity (GRAVY) 0.443
Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.327, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.209, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 10600388
Title Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif
Year 1999
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.