This work is licensed under a Creative Commons Attribution 4.0 International License.
Porcine NK-Lysin
General Information
DCTPep ID DCTPep04765
Peptide Name Porcine NK-Lysin
Sequence GLICESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKEKTGLI
Sequence Length 83
UniProt ID Not available
PubChem CID Not available
Origin Sus scrofa
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C409H704N116O116S8
Absent amino acids HY
Theoretical pI 9.33
Acidic residues 9
Basic residues 16
Polar residues 20
Molecular weight (Average) 9359.28
Molecular weight (Monoisotopic) 9353.05
Common amino acids IK
Net charge 7
Instability index (II) 30.34
Aliphatic index 106.87
Grand average of hydropathicity (GRAVY) -0.095
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5875
Abs 0.1% (=1 g/l) 0.628, assuming all pairs of Cys residues form cystines
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 0.588, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 9334742
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.