This work is licensed under a Creative Commons Attribution 4.0 International License.
Human granulysin
General Information
DCTPep ID DCTPep04766
Peptide Name Human granulysin
Sequence GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLR
Sequence Length 74
UniProt ID Not available
PubChem CID Not available
Origin Homo sapiens
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 1L9L
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C362H612N126O108S6
Absent amino acids H
Theoretical pI 10.83
Acidic residues 6
Basic residues 17
Polar residues 23
Molecular weight (Average) 8649.98
Molecular weight (Monoisotopic) 8644.46
Common amino acids R
Net charge 11
Instability index (II) 45.5
Aliphatic index 64.46
Grand average of hydropathicity (GRAVY) -0.818
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 8730
Abs 0.1% (=1 g/l) 1.009, assuming all pairs of Cys residues form cystines
Ext. coefficient 8480
Abs 0.1% (=1 g/l) 0.980, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 9756476
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.