DCTPep ID  DCTPep04777

Peptide Name   L-amino-acid oxidase

Sequence  ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVV

Sequence Length  37

UniProt ID  P0DI88 

PubChem CID  Not available

Origin  Bothrops jararaca

Type  Native peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -0.986

Half Life 
  4.4 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.347, assuming all pairs of Cys residues form cystines
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.347, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID 20615423

Title  Not available

Doi Not available

Year  Not available

Literature 2

Pubmed ID 19101583

Title  Not available

Doi Not available

Year  Not available

Literature 3

Pubmed ID 18346051

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available

DRAMP ID  DRAMP02459