This work is licensed under a Creative Commons Attribution 4.0 International License.
Endostatin fragment IV, IVox
General Information
DCTPep ID DCTPep04828
Peptide Name Endostatin fragment IV, IVox
Sequence CETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK
Sequence Length 50
UniProt ID Not available
PubChem CID Not available
Origin Collagen XVIII
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C233H371N65O78S4
Absent amino acids DP
Theoretical pI 6.74
Acidic residues 4
Basic residues 5
Polar residues 23
Molecular weight (Average) 5459.14
Molecular weight (Monoisotopic) 5455.59
Common amino acids S
Net charge 1
Instability index (II) 37.55
Aliphatic index 68.40
Grand average of hydropathicity (GRAVY) -0.152
Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7115
Abs 0.1% (=1 g/l) 1.303, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.280, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21470139
Title Anti-angiogenic peptides for cancer therapeutics
Doi 10.2174/138920111796117300
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.