General Information


DCTPep ID  DCTPep04829

Peptide Name  

Sequence  CGESCVFIPCISAIIGCSCSSKVCYKNGSIP

Sequence Length  31

UniProt ID  Not available

PubChem CID  Not available

Origin  Viola philippica

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C134H218N34O42S6

Absent amino acids  DHLMQRTW

Theoretical pI  7.77

Acidic residues  1

Basic residues  2

Polar residues  17

Molecular weight (Average)  3169.77

Molecular weight (Monoisotopic)  3167.43

Common amino acids  CS

Net charge  1

Instability index (II)  26.39

Aliphatic index  84.84

Grand average of hydropathicity (GRAVY)  0.813

Half Life 
  1.2 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1865
  Abs 0.1% (=1 g/l) 0.588, assuming all pairs of Cys residues form cystines
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.470, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.