Peptide Libraray

aa 128-167; partial loop-4+loop-5+loop-6

General Information

DCTPep ID DCTPep04836

Peptide Name aa 128-167; partial loop-4+loop-5+loop-6

Sequence CKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFAC

Sequence Length 40

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

Cancer therapy related peptides

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C207H313N53O57S7

Absent amino acids Not Applicable

Theoretical pI 6.72

Acidic residues 4

Basic residues 5

Polar residues 13

Molecular weight (Average) 4680.5

Molecular weight (Monoisotopic) 4677.13

Common amino acids C

Net charge 1

Instability index (II) 68.29

Aliphatic index 61.00

Grand average of hydropathicity (GRAVY) -0.092

Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 12740
Abs 0.1% (=1 g/l) 2.722, assuming all pairs of Cys residues form cystines
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 2.669, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US20020086420A1

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available