Monocyte chemotactic protein 1B

General Information


DCTPep ID  DCTPep04841

Peptide Name   Monocyte chemotactic protein 1B

Sequence  DAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKXXWVQDSISHLDKKNQXPKP

Sequence Length  74

UniProt ID  P80343 

PubChem CID  Not available

Origin  Bos taurus

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  Not Applicable

Absent amino acids  Not Applicable

Theoretical pI  Not Applicable

Acidic residues  Not Applicable

Basic residues  Not Applicable

Polar residues  Not Applicable

Molecular weight (Average)  Not Applicable

Molecular weight (Monoisotopic)  Not Applicable

Common amino acids  Not Applicable

Net charge  Not Applicable

Instability index (II)  Not Applicable

Aliphatic index  Not Applicable

Grand average of hydropathicity (GRAVY)  Not Applicable

Half Life 
  Not Applicable

Extinction coefficients 
  Not Applicable

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 7947749

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRAMP ID  DRAMP18114

DCTPep is developed by Dr.Zheng's team.