This work is licensed under a Creative Commons Attribution 4.0 International License.
PEDF 34-mer fragment
General Information
DCTPep ID DCTPep04850
Peptide Name PEDF 34-mer fragment
Sequence DPFFKVPVNKLAAVSNFGYDLYRVRSSMSPTTN
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin PEDF
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C169H258N44O49S1
Absent amino acids CEHIQW
Theoretical pI 9.52
Acidic residues 2
Basic residues 4
Polar residues 12
Molecular weight (Average) 3722.23
Molecular weight (Monoisotopic) 3719.88
Common amino acids SV
Net charge 2
Instability index (II) 60.83
Aliphatic index 64.85
Grand average of hydropathicity (GRAVY) -0.255
Half Life
1.1 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.801
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21470139
Title Anti-angiogenic peptides for cancer therapeutics
Doi 10.2174/138920111796117300
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.