pTnI

General Information


DCTPep ID  DCTPep04855

Peptide Name   pTnI

Sequence  EDMNQKLFDLRGKFKRPPLRRVRMSADAML

Sequence Length  30

UniProt ID  Not available

PubChem CID  Not available

Origin  Troponin I

Type  Synthetic peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C157H264N50O42S3

Absent amino acids  CHITWY

Theoretical pI  10.88

Acidic residues  4

Basic residues  8

Polar residues  3

Molecular weight (Average)  3620.31

Molecular weight (Monoisotopic)  3617.92

Common amino acids  R

Net charge  4

Instability index (II)  71.64

Aliphatic index  68.33

Grand average of hydropathicity (GRAVY)  -0.843

Half Life 
  1 hours (mammalian reticulocytes, in vitro).
  30 min (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Should not be visible by UV spectrophotometry.

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 21470139

Title  Anti-angiogenic peptides for cancer therapeutics

Doi 10.2174/138920111796117300

Year  2011

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.