pTnI
General Information
DCTPep ID DCTPep04855
Peptide Name pTnI
Sequence EDMNQKLFDLRGKFKRPPLRRVRMSADAML
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Troponin I
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C157H264N50O42S3
Absent amino acids CHITWY
Theoretical pI 10.88
Acidic residues 4
Basic residues 8
Polar residues 3
Molecular weight (Average) 3620.31
Molecular weight (Monoisotopic) 3617.92
Common amino acids R
Net charge 4
Instability index (II) 71.64
Aliphatic index 68.33
Grand average of hydropathicity (GRAVY) -0.843
Half Life
1 hours (mammalian reticulocytes, in vitro).
30 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21470139
Title Anti-angiogenic peptides for cancer therapeutics
Doi 10.2174/138920111796117300
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available