General Information


DCTPep ID  DCTPep04871

Peptide Name  

Sequence  GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQ

Sequence Length  46

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C181H290N54O64S1

Absent amino acids  CFHIKRY

Theoretical pI  3.49

Acidic residues  3

Basic residues  0

Polar residues  19

Molecular weight (Average)  4278.68

Molecular weight (Monoisotopic)  4276.08

Common amino acids  G

Net charge  -3

Instability index (II)  10.65

Aliphatic index  85.22

Grand average of hydropathicity (GRAVY)  0.054

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.285

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.