This work is licensed under a Creative Commons Attribution 4.0 International License.
General Information
DCTPep ID DCTPep04902
Peptide Name
Sequence IYSFDGRDIMTDPSWPQKVIWHGSSPHGVRLVDNYCEAWRTA
Sequence Length 42
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C220H321N61O63S2
Absent amino acids Not Applicable
Theoretical pI 6.01
Acidic residues 5
Basic residues 6
Polar residues 13
Molecular weight (Average) 4892.46
Molecular weight (Monoisotopic) 4889.32
Common amino acids DS
Net charge 1
Instability index (II) 31.33
Aliphatic index 62.62
Grand average of hydropathicity (GRAVY) -0.560
Half Life
20 hours (mammalian reticulocytes, in vitro).
30 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 19480
Abs 0.1% (=1 g/l) 3.982, assuming all pairs of Cys residues form cystines
Ext. coefficient 19480
Abs 0.1% (=1 g/l) 3.982, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.