Peptide Libraray

General Information

DCTPep ID DCTPep04933

Peptide Name

Sequence LVPRGSRAGSPSGGPFCALARQPLTGARLMSGLFFALHET

Sequence Length 40

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

Cancer therapy related peptides

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Not available

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C183H293N55O50S2

Absent amino acids DIKNWY

Theoretical pI 11.52

Acidic residues 1

Basic residues 5

Polar residues 13

Molecular weight (Average) 4127.8

Molecular weight (Monoisotopic) 4125.15

Common amino acids GL

Net charge 4

Instability index (II) 55.44

Aliphatic index 78.25

Grand average of hydropathicity (GRAVY) 0.180

Half Life
5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US6057122A

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available