Dermaseptin-like PBN2

General Information


DCTPep ID  DCTPep04935

Peptide Name   Dermaseptin-like PBN2

Sequence  MAFLKKSLFLVLFLALVPLSICEEKKSEEENEEKQEDDQSEEKRGLVTSLIKGAGKLLGGLFGSVTGGQS

Sequence Length  70

UniProt ID  Q800R4 

PubChem CID  Not available

Origin  Phyllomedusa bicolor

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C338H555N85O108S2

Absent amino acids  HWY

Theoretical pI  4.88

Acidic residues  12

Basic residues  9

Polar residues  19

Molecular weight (Average)  7601.75

Molecular weight (Monoisotopic)  7597

Common amino acids  L

Net charge  -3

Instability index (II)  60.65

Aliphatic index  98.86

Grand average of hydropathicity (GRAVY)  -0.159

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 0
  Abs 0.1% (=1 g/l) 0.000, assuming all pairs of Cys residues form cystines
  Ext. coefficient 0
  Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 18929530

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.