Dermaseptin-like PBN2
General Information
DCTPep ID DCTPep04935
Peptide Name Dermaseptin-like PBN2
Sequence MAFLKKSLFLVLFLALVPLSICEEKKSEEENEEKQEDDQSEEKRGLVTSLIKGAGKLLGGLFGSVTGGQS
Sequence Length 70
UniProt ID Q800R4
PubChem CID Not available
Origin Phyllomedusa bicolor
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C338H555N85O108S2
Absent amino acids HWY
Theoretical pI 4.88
Acidic residues 12
Basic residues 9
Polar residues 19
Molecular weight (Average) 7601.75
Molecular weight (Monoisotopic) 7597
Common amino acids L
Net charge -3
Instability index (II) 60.65
Aliphatic index 98.86
Grand average of hydropathicity (GRAVY) -0.159
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18929530
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available