Aurein 2.5
General Information
DCTPep ID DCTPep04937
Peptide Name Aurein 2.5
Sequence MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE
Sequence Length 72
UniProt ID Q5K0E4
PubChem CID Not available
Origin Litoria aurea
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C358H576N96O115S2
Absent amino acids PTWY
Theoretical pI 4.84
Acidic residues 16
Basic residues 12
Polar residues 16
Molecular weight (Average) 8129.21
Molecular weight (Monoisotopic) 8124.16
Common amino acids E
Net charge -4
Instability index (II) 44.22
Aliphatic index 90.69
Grand average of hydropathicity (GRAVY) -0.475
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 15203252
Title Host-defence peptides of Australian anurans: structure, mechanism of action and evolutionary significance
Doi 10.1016/j.peptides.2004.03.006
Year 2004
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available