Peptide Libraray

Aurein 2.5

General Information

DCTPep ID DCTPep04937

Peptide Name Aurein 2.5

Sequence MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE

Sequence Length 72

UniProt ID Q5K0E4

PubChem CID Not available

Origin Litoria aurea

Type Native peptide

Classification

Cancer therapy related peptides

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C358H576N96O115S2

Absent amino acids PTWY

Theoretical pI 4.84

Acidic residues 16

Basic residues 12

Polar residues 16

Molecular weight (Average) 8129.21

Molecular weight (Monoisotopic) 8124.16

Common amino acids E

Net charge -4

Instability index (II) 44.22

Aliphatic index 90.69

Grand average of hydropathicity (GRAVY) -0.475

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 15203252

Title Host-defence peptides of Australian anurans: structure, mechanism of action and evolutionary significance

Doi 10.1016/j.peptides.2004.03.006

Year 2004

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available