This work is licensed under a Creative Commons Attribution 4.0 International License.
General Information
DCTPep ID DCTPep04941
Peptide Name
Sequence MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVY
Sequence Length 49
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C252H386N66O74S1
Absent amino acids CT
Theoretical pI 6.52
Acidic residues 6
Basic residues 7
Polar residues 15
Molecular weight (Average) 5556.29
Molecular weight (Monoisotopic) 5552.82
Common amino acids K
Net charge 1
Instability index (II) 38.07
Aliphatic index 89.59
Grand average of hydropathicity (GRAVY) -0.410
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 15470
Abs 0.1% (=1 g/l) 2.784
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.