This work is licensed under a Creative Commons Attribution 4.0 International License.
Protein GPR15LG
General Information
DCTPep ID DCTPep04949
Peptide Name Protein GPR15LG
Sequence MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV
Sequence Length 81
UniProt ID Q6UWK7
PubChem CID Not available
Origin Homo sapiens
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C409H678N124O101S7
Absent amino acids DY
Theoretical pI 10.54
Acidic residues 3
Basic residues 17
Polar residues 22
Molecular weight (Average) 9173.07
Molecular weight (Monoisotopic) 9166.98
Common amino acids L
Net charge 14
Instability index (II) 58.3
Aliphatic index 102.22
Grand average of hydropathicity (GRAVY) 0.010
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 11375
Abs 0.1% (=1 g/l) 1.240, assuming all pairs of Cys residues form cystines
Ext. coefficient 11000
Abs 0.1% (=1 g/l) 1.199, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28936214
Title Not available
Doi Not available
Year Not available
Literature 2
Pubmed ID 28900043
Title Not available
Doi Not available
Year Not available
Literature 3
Pubmed ID 25585381
Title Not available
Doi Not available
Year Not available
Literature 4
Pubmed ID 25351403
Title Not available
Doi Not available
Year Not available
Literature 5
Pubmed ID 15265077
Title Not available
Doi Not available
Year Not available
Literature 6
Pubmed ID 12975309
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.