This work is licensed under a Creative Commons Attribution 4.0 International License.
Kunitz-type serine protease inhibitor PIVL
General Information
DCTPep ID DCTPep04959
Peptide Name Kunitz-type serine protease inhibitor PIVL
Sequence QDRPKFCYLPADPAECNAYMPRFYYDSASNKCKEFIYGGCRGNANNFKNRAECRHTCVAS
Sequence Length 60
UniProt ID I2G9B4
PubChem CID Not available
Origin Macrovipera lebetina
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C297H442N88O89S7
Absent amino acids W
Theoretical pI 8.61
Acidic residues 6
Basic residues 10
Polar residues 24
Molecular weight (Average) 6893.73
Molecular weight (Monoisotopic) 6889.08
Common amino acids ACN
Net charge 4
Instability index (II) 63.34
Aliphatic index 29.50
Grand average of hydropathicity (GRAVY) -0.847
Half Life
0.8 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7825
Abs 0.1% (=1 g/l) 1.135, assuming all pairs of Cys residues form cystines
Ext. coefficient 7450
Abs 0.1% (=1 g/l) 1.081, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 23262217
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DRAMP ID DRAMP01274
This work is licensed under a Creative Commons Attribution 4.0 International License.