Kunitz-type serine protease inhibitor PIVL

General Information


DCTPep ID  DCTPep04959

Peptide Name   Kunitz-type serine protease inhibitor PIVL

Sequence  QDRPKFCYLPADPAECNAYMPRFYYDSASNKCKEFIYGGCRGNANNFKNRAECRHTCVAS

Sequence Length  60

UniProt ID  I2G9B4 

PubChem CID  Not available

Origin  Macrovipera lebetina

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C297H442N88O89S7

Absent amino acids  W

Theoretical pI  8.61

Acidic residues  6

Basic residues  10

Polar residues  24

Molecular weight (Average)  6893.73

Molecular weight (Monoisotopic)  6889.08

Common amino acids  ACN

Net charge  4

Instability index (II)  63.34

Aliphatic index  29.50

Grand average of hydropathicity (GRAVY)  -0.847

Half Life 
  0.8 hours (mammalian reticulocytes, in vitro).
  10 min (yeast, in vivo).
  10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 7825
  Abs 0.1% (=1 g/l) 1.135, assuming all pairs of Cys residues form cystines
  Ext. coefficient 7450
  Abs 0.1% (=1 g/l) 1.081, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 23262217

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRAMP ID  DRAMP01274

DCTPep is developed by Dr.Zheng's team.