This work is licensed under a Creative Commons Attribution 4.0 International License.
Inv5, rMce1a (1-60)
General Information
DCTPep ID DCTPep05129
Peptide Name Inv5, rMce1a (1-60)
Sequence VNADIKATTVFGGKYVSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKVDP
Sequence Length 60
UniProt ID Not available
PubChem CID Not available
Origin Protein derived
Type Native peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating HeLa
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free (peptide coated FITC labelled microspheres)
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C293H489N79O92
Absent amino acids CHMW
Theoretical pI 9.60
Acidic residues 6
Basic residues 9
Polar residues 20
Molecular weight (Average) 6590.58
Molecular weight (Monoisotopic) 6586.6
Common amino acids T
Net charge 3
Instability index (II) 29.14
Aliphatic index 90.83
Grand average of hydropathicity (GRAVY) -0.270
Half Life
100 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.226
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 16620748
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 1247
This work is licensed under a Creative Commons Attribution 4.0 International License.