Inv7, rMce1a (76-109)

General Information


DCTPep ID  DCTPep05131

Peptide Name   Inv7, rMce1a (76-109)

Sequence  GLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQL

Sequence Length  34

UniProt ID  Not available

PubChem CID  Not available

Origin  Protein derived

Type  Native peptide

Classification

  

Cancer targeted peptides Membrane-targeted Cell-penetrating peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Penetrating HeLa



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free (peptide coated FITC labelled microspheres)

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C159H259N49O55S1

Absent amino acids  CWY

Theoretical pI  4.75

Acidic residues  5

Basic residues  4

Polar residues  10

Molecular weight (Average)  3769.16

Molecular weight (Monoisotopic)  3766.87

Common amino acids  DL

Net charge  -1

Instability index (II)  59.83

Aliphatic index  88.82

Grand average of hydropathicity (GRAVY)  -0.629

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Should not be visible by UV spectrophotometry.

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 16620748

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




Cppsite ID  1249

DCTPep is developed by Dr.Zheng's team.