This work is licensed under a Creative Commons Attribution 4.0 International License.
Inv7, rMce1a (76-109)
General Information
DCTPep ID DCTPep05131
Peptide Name Inv7, rMce1a (76-109)
Sequence GLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQL
Sequence Length 34
UniProt ID Not available
PubChem CID Not available
Origin Protein derived
Type Native peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating HeLa
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free (peptide coated FITC labelled microspheres)
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C159H259N49O55S1
Absent amino acids CWY
Theoretical pI 4.75
Acidic residues 5
Basic residues 4
Polar residues 10
Molecular weight (Average) 3769.16
Molecular weight (Monoisotopic) 3766.87
Common amino acids DL
Net charge -1
Instability index (II) 59.83
Aliphatic index 88.82
Grand average of hydropathicity (GRAVY) -0.629
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 16620748
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 1249
This work is licensed under a Creative Commons Attribution 4.0 International License.