This work is licensed under a Creative Commons Attribution 4.0 International License.
Inv10, rMce1a (159-188)
General Information
DCTPep ID DCTPep05134
Peptide Name Inv10, rMce1a (159-188)
Sequence ADVFDRGGPYLQRGVADLVPTATLLDTYSP
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Protein derived
Type Native peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating HeLa
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free (peptide coated FITC labelled microspheres)
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C144H223N37O46
Absent amino acids CEHIKMNW
Theoretical pI 4.14
Acidic residues 4
Basic residues 2
Polar residues 9
Molecular weight (Average) 3208.58
Molecular weight (Monoisotopic) 3206.62
Common amino acids DL
Net charge -2
Instability index (II) 30.98
Aliphatic index 91.00
Grand average of hydropathicity (GRAVY) -0.067
Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.929
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 16620748
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 1252
This work is licensed under a Creative Commons Attribution 4.0 International License.